PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna24908.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NF-YB
Protein Properties Length: 186aa    MW: 20998.4 Da    PI: 6.5223
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna24908.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.41.1e-5437132297
                    NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                              +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal+tlGf+dy eplk yl
  mrna24908.1-v1.0-hybrid  37 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALSTLGFDDYSEPLKRYL 122
                              89************************************************************************************ PP

                    NF-YB  88 kkyrelegek 97 
                              +++relegek
  mrna24908.1-v1.0-hybrid 123 HRFRELEGEK 132
                              ********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.5E-5432149IPR009072Histone-fold
SuperFamilySSF471132.17E-4039145IPR009072Histone-fold
PfamPF008088.3E-2842106IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.9E-197088No hitNo description
PROSITE patternPS0068507389IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.9E-1989107No hitNo description
PRINTSPR006151.9E-19108126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MVDNRGNNSN SIISSDSREG FNYNFSGDRD HHDDMIKEQD RLLPIANVGR IMKQILPPNA  60
KISKEAKETM QECVSEFISF VTGEASDKCH KEKRKTVNGD DICWALSTLG FDDYSEPLKR  120
YLHRFRELEG EKAQQSKANS GGEDQRNEVV EVSPTRASTT SSSTPLMKFN MMNIERGNSS  180
IPRRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4436127192Transcription factor HapC (Eurofung)
4g92_B2e-4436127192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004309676.11e-138PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO822487e-62NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLM5VPK97e-85M5VPK9_PRUPE; Uncharacterized protein
STRINGVIT_07s0104g01640.t013e-76(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.12e-62nuclear factor Y, subunit B5